Position
| Chromosome | Chr26 |
| Start | 857796 |
| End | 859164 |
| Strand | + |
view in Gbrowse: Chr26:857796..859164
Most similar sequence in NCBI nr database
| Accession | Description | E-value | Score |
|---|---|---|---|
| XP_004933012.1 | succinate dehydrogenase | 0.0 | 589 |
ORF sequence (849 bp)
ATGCCTTTGCTTAGGCTGACGACTGGTACCTTCGGGCAGCTGCGTACGTTTGCTACGTCAGCATCCCTCGCAAAACGTGTTAAGACCTTCGCAGTCTATCGATGGAACCCCGATGAGCCCGACAAGAAACCTTATACGCAAAATTTCGAAGTGGATTTGGACGACTGCGCACCTATGGTATTGGACGCTTTGCTGAAGATTAAGAACGAAGTAGACCCAACCCTGACCTTCAGACGTTCGTGCCGAGAGGGCGTTTGTGGTTCTTGTGCGATGAATATCGACGGCGTCAACACTCTGGCCTGCATCAGCCATATCGATCAAAACATTTCCAAGCCGACGAAGATTTATCCTCTACCTCACATGTACGTCGTCAAAGACTTGGTCCCCGATCTGACCAACTTTTACCGGCAGTACCAGTCTATCGAGCCGTGGCTGCAGCGTGAAAATGAAGCTGTTAAAGGTAAGGAGACTCAATTGCTCCAGGACGTAGAGGACCGCGTCAAGTTGGATGGTCTCTATGAATGTGTGCTATGTGCTTGCTGTTCGACGAGTTGCCCGTCCTACTGGTGGAATGGAGATAAGTACCTAGGCCCTGCTGTCCTCATGCAGGCCTACAGGTGGATCATTGACTCCCGAGATGAAGCCACTGAGAAACGTTTATCAAAACTCAAGGACACATACTCGGTATACCGTTGCCATACAATCATGAACTGCACTCGCACATGCCCTAAAGGTCTGAACCCAGGCCGGGCCATTGCCCAGATCAAAACCTTACTCTCGGGTATAGTTAAGAAGCAGCCACCTATAATGGACCCTGCTGGCTTGCAGAAGCAGACAGCGAGCAATTAA
Protein sequence (282 aa)
MPLLRLTTGTFGQLRTFATSASLAKRVKTFAVYRWNPDEPDKKPYTQNFEVDLDDCAPMVLDALLKIKNEVDPTLTFRRSCREGVCGSCAMNIDGVNTLACISHIDQNISKPTKIYPLPHMYVVKDLVPDLTNFYRQYQSIEPWLQRENEAVKGKETQLLQDVEDRVKLDGLYECVLCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDEATEKRLSKLKDTYSVYRCHTIMNCTRTCPKGLNPGRAIAQIKTLLSGIVKKQPPIMDPAGLQKQTASN
Corresponding sequences in KAIKObase version 1
BMgn010790Domains and motifs
| Database | ID | Description | Start | End | Evalue | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | PTHR11921 | - | 13 | 264 | 0.0 | - |
| PANTHER | PTHR11921:SF29 | - | 13 | 264 | 0.0 | - |
| Gene3D | 3.10.20.30 | - | 17 | 130 | 2.0e-48 | IPR012675 |
| SUPERFAMILY | SSF54292 | - | 26 | 130 | 1.9e-30 | IPR036010 |
| Pfam | PF13085 | 2Fe-2S iron-sulfur cluster binding domain | 29 | 135 | 9.7e-34 | IPR025192 |
| ProSiteProfiles | PS51085 | 2Fe-2S ferredoxin-type iron-sulfur binding domain profile. | 30 | 121 | 9.502 | IPR001041 |
| TIGRFAM | TIGR00384 | dhsB: succinate dehydrogenase and fumarate reductase iron-sulfur protein | 32 | 256 | 3.2e-84 | IPR004489 |
| CDD | cd00207 | fer2 | 49 | 94 | 1.4e-03 | IPR001041 |
| ProSitePatterns | PS00197 | 2Fe-2S ferredoxin-type iron-sulfur binding region signature. | 81 | 89 | - | IPR006058 |
| Gene3D | 1.10.1060.10 | - | 131 | 275 | 2.8e-61 | IPR009051 |
| SUPERFAMILY | SSF46548 | - | 132 | 258 | 1.0e-34 | IPR009051 |
| ProSiteProfiles | PS51379 | 4Fe-4S ferredoxin-type iron-sulfur binding domain profile. | 165 | 195 | 7.634 | IPR017896 |
| Pfam | PF13534 | 4Fe-4S dicluster domain | 174 | 247 | 3.6e-09 | - |
| ProSitePatterns | PS00198 | 4Fe-4S ferredoxin-type iron-sulfur binding region signature. | 175 | 186 | - | IPR017900 |
InterPro assignment
| InterPro ID | InterPro description |
|---|---|
| IPR001041 | 2Fe-2S ferredoxin-type iron-sulfur binding domain |
| IPR004489 | Succinate dehydrogenase/fumarate reductase iron-sulphur protein |
| IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site |
| IPR009051 | Alpha-helical ferredoxin |
| IPR012675 | Beta-grasp domain superfamily |
| IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
| IPR025192 | Succinate dehydogenase/fumarate reductase N-terminal |
| IPR036010 | 2Fe-2S ferredoxin-like superfamily |
Gene ontology (GO) assignment
| GO category | GO ID | GO description |
|---|---|---|
| biological process | GO:0006099 | tricarboxylic acid cycle |
| molecular function | GO:0009055 | electron transfer activity |
| molecular function | GO:0016491 | oxidoreductase activity |
| molecular function | GO:0051536 | iron-sulfur cluster binding |
| molecular function | GO:0051537 | 2 iron, 2 sulfur cluster binding |
| biological process | GO:0055114 | oxidation-reduction process |
| Species | Accession |
|---|---|
| Danaus plexippus | DPOGS201688 |
| Heliconius melpomene | HMEL016878g1.t1 |
| Manduca sexta | XP_030035851.1 |
| Plutella xylostella | g35884.t1 |
| Spodoptera frugiperda (corn) | GSSPFG00000358001-PA |
| Spodoptera frugiperda (rice) | SFRICE000389-PA |
| Acyrthosiphon pisum | NP_001155908.1 |
| Aedes aegypti | AAEL010330-PA |
| Anopheles gambiae | AGAP007309-PA |
| Apis mellifera | XP_026295167.1 |
| Drosophila melanogaster | FBpp0085489 |
| Tribolium castaneum | NP_001164360.1 |
| Homo sapiens | NP_002991.2 |
| Mus musculus | NP_001342444.1 |
The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.
The Y axis is the abundance value (transcripts per million (TPM))
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis
For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.
Expression data of KWMTBOMO15500:
The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.
The Y axis is the abundance value with log10 conversion (value of transcripts per million (TPM) plus 1 is used to avoid negative output)
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis
For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.