Position
Chromosome | Chr26 |
Start | 6763187 |
End | 6771509 |
Strand | - |
view in Gbrowse: Chr26:6763187..6771509
Most similar sequence in NCBI nr database
Accession | Description | E-value | Score |
---|---|---|---|
XP_021204174.1 | uncharacterized protein LOC101744633 | 1e-166 | 499 |
ORF sequence (720 bp)
ATGAAGTCCCCTACAGAACAACCGGAACAATCGAAAAAATCTGAGAAAAAATTCAAGGCACTGCTAGATCTACTCTTAGATTTATCAGCAGAAGATTCTCTGACTGGACCAGAGATATTAGAAGAGCTGAATACAGCCGTGTTCGGAGGATACGACACTACATCCTGTACTTTAACTTACGTCCTGATGAACTTGGGAACGTATCAAGACGTCCAACAGAAAATGTACGAAGAAATAAAAAATGTATTCGGCGATTCCGAGCGGGATGTCGAAAGCGATGACCTTAGTAAACTAGTTTATACAGAAGCAGTAATTAAAGAATCCCTGAGACTGTATCCTATCGCTCCTATCATATTTAGGGAATTAGACCAAGATGTTAAGATAAATAATTATACGCTGAAGGCTGGTCGTGGCTGCGCAATTAACGTTTACGGCATAAACCGGCACGCAATGTGGGGTGATGACGCGGACAAATTCAGACCGGAGCGTTGGTTGGAGCCGGACGGAGTGCCAAGCGTGTACTACGCGTTTGCTACATTCGGCGTAGGAAAGCGAGCGTGTATCGGTAGGACATATGCAATGATGAGCATGAAGACAACCTTAGTACACATCTTGCGCCAGTTTCGAATTGCTGCTGACATCACCAAGATTGAATTCAAGATTGAAATCATTTTGGTTCCACAGACACCCTGCTACTTAACTTTAGAAAGGAGATCTTGA
Protein sequence (239 aa)
MKSPTEQPEQSKKSEKKFKALLDLLLDLSAEDSLTGPEILEELNTAVFGGYDTTSCTLTYVLMNLGTYQDVQQKMYEEIKNVFGDSERDVESDDLSKLVYTEAVIKESLRLYPIAPIIFRELDQDVKINNYTLKAGRGCAINVYGINRHAMWGDDADKFRPERWLEPDGVPSVYYAFATFGVGKRACIGRTYAMMSMKTTLVHILRQFRIAADITKIEFKIEIILVPQTPCYLTLERRS
Corresponding sequences in KAIKObase version 1
BMgn002272Domains and motifs
Database | ID | Description | Start | End | Evalue | InterPro ID |
---|---|---|---|---|---|---|
Gene3D | 1.10.630.10 | - | 2 | 239 | 3.3e-76 | IPR036396 |
PANTHER | PTHR24291 | - | 6 | 238 | 1.3e-64 | - |
PANTHER | PTHR24291:SF140 | - | 6 | 238 | 1.3e-64 | - |
Pfam | PF00067 | Cytochrome P450 | 10 | 231 | 5.3e-61 | IPR001128 |
SUPERFAMILY | SSF48264 | - | 15 | 238 | 2.7e-67 | IPR036396 |
ProSitePatterns | PS00086 | Cytochrome P450 cysteine heme-iron ligand signature. | 180 | 189 | - | IPR017972 |
InterPro assignment
InterPro ID | InterPro description |
---|---|
IPR001128 | Cytochrome P450 |
IPR017972 | Cytochrome P450, conserved site |
IPR036396 | Cytochrome P450 superfamily |
Gene ontology (GO) assignment
GO category | GO ID | GO description |
---|---|---|
molecular function | GO:0005506 | iron ion binding |
molecular function | GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
molecular function | GO:0020037 | heme binding |
biological process | GO:0055114 | oxidation-reduction process |
Species | Accession |
---|---|
Danaus plexippus | - |
Heliconius melpomene | HMEL010930-RA HMEL010931-RA HMEL010935-RA HMEL013954-RA HMEL013955-RA HMEL020379g1.t1 HMEL020379g2.t1 HMEL022586g1.t1 HMEL034613g1.t1 |
Manduca sexta | - |
Plutella xylostella | g11328.t1 g36022.t1 |
Spodoptera frugiperda (corn) | GSSPFG00005210001-PA GSSPFG00005705001-PA |
Spodoptera frugiperda (rice) | SFRICE003277.2-PA SFRICE015299.2-PA SFRICE020096.2-PA SFRICE034709-PA |
Acyrthosiphon pisum | - |
Aedes aegypti | - |
Anopheles gambiae | - |
Apis mellifera | - |
Drosophila melanogaster | - |
Tribolium castaneum | - |
Homo sapiens | - |
Mus musculus | - |
The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.
The Y axis is the abundance value (transcripts per million (TPM))
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis
For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.
Expression data of KWMTBOMO15695:
Expression data of alternative splicing isoform(s) of KWMTBOMO15695:
MSTRG.15353.1 (position: Chr26:6763187..6779790)
MSTRG.15353.2 (position: Chr26:6763187..6793147)
MSTRG.15353.4 (position: Chr26:6763228..6778244)
MSTRG.15353.5 (position: Chr26:6763228..6774282)
The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.
The Y axis is the abundance value with log10 conversion (value of transcripts per million (TPM) plus 1 is used to avoid negative output)
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis
For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.
Expression data of KWMTBOMO15695:
Expression data of alternative splicing isoform(s) of KWMTBOMO15695:
MSTRG.15353.1 (position: Chr26:6763187..6779790)
MSTRG.15353.2 (position: Chr26:6763187..6793147)
MSTRG.15353.4 (position: Chr26:6763228..6778244)
MSTRG.15353.5 (position: Chr26:6763228..6774282)