KWMTBOMO14663

Position

Chromosome	Chr24
Start	12208762
End	12227158
Strand	+

view in Gbrowse: Chr24:12208762..12227158

Most similar sequence in NCBI nr database

Accession	Description	E-value	Score
NP_001040435.1	glutathione S-transferase omega 3	9e-180	502

ORF sequence (723 bp)

ATGACTTATTTTCACTCCGTAAACGCCGGTGTGATTCCGCCACCGGCTCTGACGGACAAGCTTCGTCTGTACCATGTCGACATGAACCCGTACGGTCACAGGGTGCTCCTCGTCCTCGAAGCCAAGAGGATCAAGTATGAGGTCTACAGGCTCGACCCGCTGAGGCTGCCGGAGTGGTTCCGTGCGAAGAACCCCAGATTGAAGATTCCGGTGCTGGAGATTCCTACGGACCAGGGGGACAGGTTCCTCTTCGAAAGCGTCGTGATCTGCGATTACCTGGATGAGAAGTACACGAGGCACACGCTCCACTCCCACGACCCTTACGTCAAGGCCCAGGACCGGTTGCTGATCGAAAGATTCAACGAGCTCATAAAAGGCAGCCTAGAATGCTTCGACACGAACTTCGCTTTCGGAAGTGAGCAGATCATCCAGACGCTGGAGATCTTCGAGAAGGAATTGACTAACAGAGGTACAAATTACTTCGGCGGTAACCGGCCTGGAATGCTGGACTACATGGTCTGGCCTTGGGTCGAGAGGCTGTACCTCCTGAGGTGTGTCAACGATAGAAAATTCGTGGAGAAGAAATCGCTTTTCCCTAATTTCGCGGACTGGGGTGATCAAATGCAACTAGATGATATCGTTAAGAAGCACGCGCATTCGCCTCAAGAGTATTTCGATTACTACAAAAACGCTAGAGCGCATTCTATGGGCTATTATTTGTAG

Protein sequence (240 aa)

MTYFHSVNAGVIPPPALTDKLRLYHVDMNPYGHRVLLVLEAKRIKYEVYRLDPLRLPEWFRAKNPRLKIPVLEIPTDQGDRFLFESVVICDYLDEKYTRHTLHSHDPYVKAQDRLLIERFNELIKGSLECFDTNFAFGSEQIIQTLEIFEKELTNRGTNYFGGNRPGMLDYMVWPWVERLYLLRCVNDRKFVEKKSLFPNFADWGDQMQLDDIVKKHAHSPQEYFDYYKNARAHSMGYYL

Corresponding sequences in KAIKObase version 1

BMgn009607

Domains and motifs

Database	ID	Description	Start	End	Evalue	InterPro ID
PANTHER	PTHR43968	-	7	233	3.9e-56	-
PANTHER	PTHR43968:SF6	-	7	233	3.9e-56	-
Gene3D	3.40.30.10	-	13	229	2.3e-85	-
ProSiteProfiles	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	19	101	20.565	IPR004045
SUPERFAMILY	SSF52833	-	20	123	5.5e-24	IPR036249
Pfam	PF13417	Glutathione S-transferase, N-terminal domain	23	98	8.4e-18	IPR004045
SUPERFAMILY	SSF47616	-	95	232	4.6e-20	IPR036282
Gene3D	1.20.1050.10	-	106	222	2.3e-85	-
ProSiteProfiles	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	106	227	10.117	IPR010987
Pfam	PF13410	Glutathione S-transferase, C-terminal domain	140	204	7.9e-08	-

InterPro assignment

InterPro ID	InterPro description
IPR004045	Glutathione S-transferase, N-terminal
IPR010987	Glutathione S-transferase, C-terminal-like
IPR036249	Thioredoxin-like superfamily
IPR036282	Glutathione S-transferase, C-terminal domain superfamily

Gene ontology (GO) assignment

GO category	GO ID	GO description
molecular function	GO:0005515	protein binding

Species	Accession
Danaus plexippus	DPOGS215101
Heliconius melpomene	HmelGSTo3.mrna
Manduca sexta	XP_030034734.1
Plutella xylostella	g26115.t1
Spodoptera frugiperda (corn)	GSSPFG00010021001.5-PA
Spodoptera frugiperda (rice)	SFRICE009488-PA SFRICE028596.2-PA
Acyrthosiphon pisum	-
Aedes aegypti	-
Anopheles gambiae	-
Apis mellifera	-
Drosophila melanogaster	-
Tribolium castaneum	-
Homo sapiens	-
Mus musculus	-

The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.

The Y axis is the abundance value (transcripts per million (TPM))
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis

For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.

Expression data of KWMTBOMO14663:

Expression data of alternative splicing isoform(s) of KWMTBOMO14663:

MSTRG.14024.1 (position: Chr24:12192197..12228171)

MSTRG.14024.2 (position: Chr24:12208290..12228346)

MSTRG.14024.3 (position: Chr24:12208290..12228171)

The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.

The Y axis is the abundance value with log₁₀ conversion (value of transcripts per million (TPM) plus 1 is used to avoid negative output)
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis

For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.

Expression data of KWMTBOMO14663:

Expression data of alternative splicing isoform(s) of KWMTBOMO14663:

MSTRG.14024.1 (position: Chr24:12192197..12228171)

MSTRG.14024.2 (position: Chr24:12208290..12228346)

MSTRG.14024.3 (position: Chr24:12208290..12228171)