Position
| Chromosome | Chr11 |
| Start | 10575346 |
| End | 10578454 |
| Strand | - |
view in Gbrowse: Chr11:10575346..10578454
Most similar sequence in NCBI nr database
| Accession | Description | E-value | Score |
|---|---|---|---|
| XP_028041031.1 | pyrimidodiazepine synthase-like | 0.0 | 528 |
ORF sequence (765 bp)
ATGTCCGAGAAGCATTTACAAACCGGAGATGTTTTGCCCCCATATAGTGGAAAACTTCGCGTTTTTGCTATGAGATTTTGTCCTTACGCCGAAAGGACAGTGCTGACCTTAAATGCTAAAAACATACCTTACGATTTAGTTTTTATCAATTTAGATCAGAAACCTGAATGGATCTTCAACTTTAGCCCGAAGGGTACTGTGCCAGCTTTGGAATATGAACCTGGTAAGGCACTCTTTGACAGCAACATTATAAATGTTTATCTTGATGAAAAGTATCCAGAGATTCCTCTGCAAGCATCAGACCCTCTGCGCAGAGCTCAAGACAAAATTCTCGTTGAGAGCTTTGCTCCAGCACAATCAGCTTACTATACAGCAGCATTCAATGCACAAGCTCTCGAGCCAAGCATGGTAGAGACATACCACAAAGGACTTGAGGGACTACAAAAAGAGCTTGAAACGCGCAGTACTAAATATTTACATGGGGACGAGCCTGGGTGGGTCGATTACACCCTTTGGCCATTTTTAGAGCGCTTTGAGGCTCTGCCCCTGATTGGAAAAGCTGAGTTTGCCATTGACAAAACTAAATATGAGAGACTGGTTACTTACATTGAAGCCATGAAAAATGTGCCTGCTGTGAAGTCGTACTTCTTAGCAGCAGAGACCCATGCGAAGTTCATTGAGTCTCGCGCCAAAGGAGATGCCAATTACAATATGCTAGACACTAGTGCTGTTTGCTGCATGCGCCCCAGGAAAAAGAAGGAATAA
Protein sequence (254 aa)
MSEKHLQTGDVLPPYSGKLRVFAMRFCPYAERTVLTLNAKNIPYDLVFINLDQKPEWIFNFSPKGTVPALEYEPGKALFDSNIINVYLDEKYPEIPLQASDPLRRAQDKILVESFAPAQSAYYTAAFNAQALEPSMVETYHKGLEGLQKELETRSTKYLHGDEPGWVDYTLWPFLERFEALPLIGKAEFAIDKTKYERLVTYIEAMKNVPAVKSYFLAAETHAKFIESRAKGDANYNMLDTSAVCCMRPRKKKE
Corresponding sequences in KAIKObase version 1
BMgn011819Domains and motifs
| Database | ID | Description | Start | End | Evalue | InterPro ID |
|---|---|---|---|---|---|---|
| PANTHER | PTHR43968 | - | 3 | 235 | 1.2e-62 | - |
| Gene3D | 3.40.30.10 | - | 5 | 229 | 6.1e-80 | - |
| ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 17 | 96 | 18.046 | IPR004045 |
| SUPERFAMILY | SSF52833 | - | 18 | 113 | 1.5e-23 | IPR036249 |
| Pfam | PF13417 | Glutathione S-transferase, N-terminal domain | 22 | 94 | 6.1e-17 | IPR004045 |
| Gene3D | 1.20.1050.10 | - | 98 | 217 | 6.1e-80 | - |
| SUPERFAMILY | SSF47616 | - | 100 | 235 | 6.7e-20 | IPR036282 |
| ProSiteProfiles | PS50405 | Soluble glutathione S-transferase C-terminal domain profile. | 101 | 234 | 16.267 | IPR010987 |
| Pfam | PF13410 | Glutathione S-transferase, C-terminal domain | 136 | 205 | 9.8e-11 | - |
InterPro assignment
| InterPro ID | InterPro description |
|---|---|
| IPR004045 | Glutathione S-transferase, N-terminal |
| IPR010987 | Glutathione S-transferase, C-terminal-like |
| IPR036249 | Thioredoxin-like superfamily |
| IPR036282 | Glutathione S-transferase, C-terminal domain superfamily |
Gene ontology (GO) assignment
| GO category | GO ID | GO description |
|---|---|---|
| molecular function | GO:0005515 | protein binding |
| Species | Accession |
|---|---|
| Danaus plexippus | DPOGS213590 |
| Heliconius melpomene | HmelGSTo1.mrna |
| Manduca sexta | XP_030020000.1 |
| Plutella xylostella | g25873.t1 |
| Spodoptera frugiperda (corn) | GSSPFG00020910001.3-PA |
| Spodoptera frugiperda (rice) | SFRICE010915.2-PA |
| Acyrthosiphon pisum | NP_001155757.1 |
| Aedes aegypti | AAEL017085-PA |
| Anopheles gambiae | AGAP005749-PA |
| Apis mellifera | XP_006569695.1 XP_624501.1 |
| Drosophila melanogaster | FBpp0076348 FBpp0076349 |
| Tribolium castaneum | XP_967412.1 |
| Homo sapiens | - |
| Mus musculus | - |
The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.
The Y axis is the abundance value (transcripts per million (TPM))
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis
For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.
Expression data of KWMTBOMO06566:
The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.
The Y axis is the abundance value with log10 conversion (value of transcripts per million (TPM) plus 1 is used to avoid negative output)
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis
For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.