KWMTBOMO03300

Position

Chromosome	Chr6
Start	3800699
End	3808641
Strand	-

view in Gbrowse: Chr6:3800699..3808641

Most similar sequence in NCBI nr database

Accession	Description	E-value	Score
NP_001108462.1	glutathione S-transferase unclassified 1	1e-172	483

ORF sequence (702 bp)

ATGGTTCTAAAATTATATGCCGTTTCTGATGGCCCTCCATCGCTCTCTGTGAGGCAAGCCCTTGTCGCGCTTGAAGTACCATTTGAATTGATTAATGTGGACTTCGGCGCTGGGGAGCATATGACATCAGATTATGCCCTGATGAATCCACAAAAAGAAATTCCTGTTCTTGACGATGAAGGTTTCTATTTGAGCGAAAGCAATGCTATCCTACAATATATATGTGATAAGTACCGTCCTGGCTCACCTTTGTACCCACAGGATCCTAAGTCCAGAGCTATCGTAAACCACCGTCTCTGTTTTAACTTATCAAGCTATTATGCTAATATCTCAGCCTACACAATGGCACCTATATTCTTTGACTACGAACGCACTCCACTGGGTCTCAAAAAAGTTCACATCTCATTAGATGTTCTTGAGACTTACCTAACCAGAACAAACACATCCTATGCGGCGGCCAACCACCTGACTATAGCTGATTTCCCCTTGATCAACTCTACTATGACATTAGAAGCTATAGATTTTGACTTTTCCAAATACACGAAGATACACAAATGGTACAATGATTTTAAGGTGAAGTATCCAGATTTATGGAAAATTTCGGAAAGCGCCATGAAAGAGATCCAACATTTTGCCGCTAACCCTCCAGACTTGACTCACCTCAACCATCCTATACACCCTATCCGAAAAATCAAAAATTAA

Protein sequence (233 aa)

MVLKLYAVSDGPPSLSVRQALVALEVPFELINVDFGAGEHMTSDYALMNPQKEIPVLDDEGFYLSESNAILQYICDKYRPGSPLYPQDPKSRAIVNHRLCFNLSSYYANISAYTMAPIFFDYERTPLGLKKVHISLDVLETYLTRTNTSYAAANHLTIADFPLINSTMTLEAIDFDFSKYTKIHKWYNDFKVKYPDLWKISESAMKEIQHFAANPPDLTHLNHPIHPIRKIKN

Corresponding sequences in KAIKObase version 1

BMgn006425

Domains and motifs

Database	ID	Description	Start	End	Evalue	InterPro ID
Gene3D	3.40.30.10	-	1	80	1.0e-21	-
Pfam	PF02798	Glutathione S-transferase, N-terminal domain	1	74	2.3e-15	IPR004045
ProSiteProfiles	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	1	82	20.11	IPR004045
SUPERFAMILY	SSF52833	-	1	87	2.4e-21	IPR036249
PANTHER	PTHR43969	-	3	230	0.0	-
PANTHER	PTHR43969:SF7	-	3	230	0.0	-
SUPERFAMILY	SSF47616	-	73	190	1.8e-19	IPR036282
Gene3D	1.20.1050.10	-	81	214	1.4e-34	-
ProSiteProfiles	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	88	216	13.908	IPR010987
CDD	cd03177	GST_C_Delta_Epsilon	90	187	8.2e-29	-
Pfam	PF00043	Glutathione S-transferase, C-terminal domain	129	189	3.4e-05	IPR004046

InterPro assignment

InterPro ID	InterPro description
IPR004045	Glutathione S-transferase, N-terminal
IPR004046	Glutathione S-transferase, C-terminal
IPR010987	Glutathione S-transferase, C-terminal-like
IPR036249	Thioredoxin-like superfamily
IPR036282	Glutathione S-transferase, C-terminal domain superfamily

Gene ontology (GO) assignment

GO category	GO ID	GO description
molecular function	GO:0005515	protein binding

Species	Accession
Danaus plexippus	DPOGS208235
Heliconius melpomene	HmelGSTu1.mrna
Manduca sexta	XP_030029909.1 XP_030029915.1 XP_030029923.1
Plutella xylostella	g22749.t1 g2440.t2
Spodoptera frugiperda (corn)	GSSPFG00014483001.3-PA
Spodoptera frugiperda (rice)	SFRICE009253.2-PA SFRICE016627-PA
Acyrthosiphon pisum	-
Aedes aegypti	AAEL011752-PA
Anopheles gambiae	AGAP000947-PA
Apis mellifera	XP_026296300.1
Drosophila melanogaster	FBpp0113023
Tribolium castaneum	XP_975048.1
Homo sapiens	-
Mus musculus	-

The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.

The Y axis is the abundance value (transcripts per million (TPM))
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis

For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.

Expression data of KWMTBOMO03300:

Expression data of alternative splicing isoform(s) of KWMTBOMO03300:

MSTRG.19336.1 (position: Chr6:3800639..3813071)

The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.

The Y axis is the abundance value with log₁₀ conversion (value of transcripts per million (TPM) plus 1 is used to avoid negative output)
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis

For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.

Expression data of KWMTBOMO03300:

Expression data of alternative splicing isoform(s) of KWMTBOMO03300:

MSTRG.19336.1 (position: Chr6:3800639..3813071)