KWMTBOMO01001

Position

Chromosome	Chr2
Start	8224287
End	8227421
Strand	-

view in Gbrowse: Chr2:8224287..8227421

Most similar sequence in NCBI nr database

Accession	Description	E-value	Score
XP_028039858.1	fibrohexamerin	1e-163	459

ORF sequence (663 bp)

ATGCTGGCGCGGTGTCTAGCTGTAGCCGCTGTGGCAGTTTTGGCTTCTGCAGGGCCGCCGAGTCCGATCTACAGGCCCTGCTACTTGGACGATTACAAATGCATCTCCGACCACCTGGCCGCGATCTCGAAATGTATCCCGGGCAGAGGGCAGATCCCCTCGCAGTACGAGATACCGGTGTTCCAGTTTGAAATACCATACTTCAACGCCACCTACGTCGACCATAATCTCATTACCCGTAACCACGACAAATGCCGTGTCAGCGAATTTTATGACAATGTGAGAACTTTAAAAACAGTTTTAACCGTGGACTGTCCGTGGCTGAACTTTGAATCCAATCGGACCTTGGCTCAGCACATGTCGTTCAAGGAAGACGTCGTCTTAAGCTTCTACATCAATGGATCTTATCCTTTGATCAGGCTAACGACAGTGTTTGATAAGGGCAACAATTTCGACTTGTGTTCGGCTTTCACGTTCGCAGACCTGGCCGGGGGTCTGCCCATCTTCCACATTAACCCTAATGACCAACGCACAGCGCAGTGGTTGTCTAAAGATCTGACCCTGCTGCACATTTACGAGAGAGAGCACATCTTCGGAAAGAGGAACTGGCTGGCGAGGTCCTTCATCAGCAGAACACTCTGCGACTTCGGTTGTCACCACTGA

Protein sequence (220 aa)

MLARCLAVAAVAVLASAGPPSPIYRPCYLDDYKCISDHLAAISKCIPGRGQIPSQYEIPVFQFEIPYFNATYVDHNLITRNHDKCRVSEFYDNVRTLKTVLTVDCPWLNFESNRTLAQHMSFKEDVVLSFYINGSYPLIRLTTVFDKGNNFDLCSAFTFADLAGGLPIFHINPNDQRTAQWLSKDLTLLHIYEREHIFGKRNWLARSFISRTLCDFGCHH

Corresponding sequences in KAIKObase version 1

BMgn001347

Domains and motifs

Database	ID	Description	Start	End	Evalue	InterPro ID
PIRSF	PIRSF008881	-	1	220	1.5e-119	IPR009911
Pfam	PF07294	Fibroin P25	23	218	2.6e-123	IPR009911

InterPro assignment

InterPro ID	InterPro description
IPR009911	Fibroin P25

Gene ontology (GO) assignment

GO category	GO ID	GO description
molecular function	GO:0005198	structural molecule activity
cellular component	GO:0005576	extracellular region

Species	Accession
Danaus plexippus	DPOGS203585
Heliconius melpomene	HMEL015869g1.t1
Manduca sexta	XP_030026208.1
Plutella xylostella	g20597.t1 g37868.t1
Spodoptera frugiperda (corn)	GSSPFG00025266001-PA
Spodoptera frugiperda (rice)	SFRICE005043-PA
Acyrthosiphon pisum	-
Aedes aegypti	-
Anopheles gambiae	-
Apis mellifera	-
Drosophila melanogaster	-
Tribolium castaneum	-
Homo sapiens	-
Mus musculus	-

The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.

The Y axis is the abundance value (transcripts per million (TPM))
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis

For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.

Expression data of KWMTBOMO01001:

Expression data of alternative splicing isoform(s) of KWMTBOMO01001:

MSTRG.10154.1 (position: Chr2:8224184..8225769)

The expression data was obtained from RNA-seq data of ten tissues/locations.
Three replicates were sequenced from each tissue/location.

The Y axis is the abundance value with log₁₀ conversion (value of transcripts per million (TPM) plus 1 is used to avoid negative output)
The X axis is the tissues/locations with the following abbreviations:
ASG: anterior silk gland; FB: fat body; MG: midgut;
MSG_A: middle silk gland (anterior); MSG_M: middle silk gland (middle); MSG_P: middle silk gland (posterior);
MT: Malpighian tubules; OV: ovary; PSG: posterior silk gland; TT: testis

For more details, please refer to the article "Reference transcriptome data in silkworm Bombyx mori" (Yokoi et al., 2019).
Expression data (TPM) can be obtained from National Bioscience Database Center.

Expression data of KWMTBOMO01001:

Expression data of alternative splicing isoform(s) of KWMTBOMO01001:

MSTRG.10154.1 (position: Chr2:8224184..8225769)